PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_14639.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 247aa    MW: 25035 Da    PI: 8.2211
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_14639.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022312e-71111722154
        DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                   +sgt++CqdCGnqakkdC+h+RCRtCCksrgfdC+thvkstWvpaa+rrerq+   +a s+ a+++++a sk++r l+s++q+++s+t++s+a++++
  MLOC_14639.1  11 GSGTTTCQDCGNQAKKDCTHSRCRTCCKSRGFDCSTHVKSTWVPAARRRERQHLGGSA-SSPANASTAAGSKKPRLLSSQQQATTSHTSTSNATTPR 106
                   57999*********************************************97766665.66667789999*************************** PP

        DUF702  99 eletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                   + +t+s          lP++v+++avfrcvrv+s+ddge+e+aYq++v+i+GhvfkG+LydqG+++
  MLOC_14639.1 107 SYDTTSshqdasfrgnLPRQVRAPAVFRCVRVTSIDDGEDEYAYQATVTINGHVFKGFLYDQGVDD 172
                   **999999*******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.4E-6314171IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.0E-271658IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.1E-29123170IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MLDGGGDGSS GSGTTTCQDC GNQAKKDCTH SRCRTCCKSR GFDCSTHVKS TWVPAARRRE  60
RQHLGGSASS PANASTAAGS KKPRLLSSQQ QATTSHTSTS NATTPRSYDT TSSHQDASFR  120
GNLPRQVRAP AVFRCVRVTS IDDGEDEYAY QATVTINGHV FKGFLYDQGV DDGRASNDID  180
PSTGGAVPNM SELHLGGGGG NAARGGGGSS SMAPSDMYGG GGAGGAGGGG GGQHILGGGS  240
SYGNTMN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3556430.0AK355643.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1023M22.
GenBankAK3635540.0AK363554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2016K14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622050.11e-100PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK91e-66LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLM0UVA51e-179M0UVA5_HORVD; Uncharacterized protein
STRINGMLOC_14639.11e-179(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35793679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.22e-51Lateral root primordium (LRP) protein-related